SCOPe 2.04: Domain d3emya_: 3emy A:

Lineage for d3emya_ (3emy A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.0: automated matches [191552] (1 protein)
   not a true family

6. Protein automated matches [190954] (8 species)
   not a true protein

7. Species Hypocrea jecorina [TaxId:51453] [188627] (1 PDB entry)

8. Domain d3emya_: 3emy A: [175093]
   automated match to d1e5oe_

Details for d3emya_

PDB Entry: 3emy, 1.85 Å

PDB Description: crystal structure of trichoderma reesei aspartic proteinase complexed with pepstatin a

PDB Compounds: (A:) Trichoderma reesei Aspartic protease

SCOPe Domain Sequences for d3emya_:

Sequence; same for both SEQRES and ATOM records:

>d3emya_ b.50.1.0 (A:) automated matches {Hypocrea jecorina [TaxId: 51453]}
etgsapnhpsdsadseyitsvsigtpaqvlpldfdtgssdlwvfssetpkssatghaiyt
psksstskkvsgaswsisygdgssssgdvytdkvtiggfsvntqgvesatrvstefvqdt
visglvglafdsgnqvrphpqktwfsnaasslaeplftadlrhgqngsynfgyidtsvak
gpvaytpvdnsqgfweftasgysvgggklnrnsidgiadtgttllllddnvvdayyanvq
saqydnqqegvvfdcdedlpsfsfgvgsstitipgdllnltpleegsstcfgglqsssgi
ginifgdvalkaalvvfdlgnerlgwaqk

Timeline for d3emya_:

• d3emya_ first appeared in SCOPe 2.01
  
• d3emya_ appears in SCOPe 2.03
  
• d3emya_ appears in SCOPe 2.05
  
• d3emya_ appears in the current release, SCOPe 2.08