Lineage for d3elxa1 (3elx A:1-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805779Species Zebrafish (Danio rerio) [TaxId:7955] [188731] (3 PDB entries)
  8. 2805780Domain d3elxa1: 3elx A:1-130 [175065]
    Other proteins in same PDB: d3elxa2, d3elxa3
    automated match to d1o1ua_
    complexed with edo

Details for d3elxa1

PDB Entry: 3elx (more details), 1.6 Å

PDB Description: Crystal structure of apo Zebrafish Ileal Bile Acid-Binding Protein
PDB Compounds: (A:) Ileal bile acid-binding protein

SCOPe Domain Sequences for d3elxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3elxa1 b.60.1.0 (A:1-130) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
afngkwetesqegyepfckligipddviakgrdfklvteivqngddftwtqyypnnhvvt
nkfivgkesdmetvggkkfkgivsmeggkltisfpkyqqtteisggklvetstasgaqgt
avlvrtskkv

SCOPe Domain Coordinates for d3elxa1:

Click to download the PDB-style file with coordinates for d3elxa1.
(The format of our PDB-style files is described here.)

Timeline for d3elxa1: