Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [188731] (3 PDB entries) |
Domain d3elxa1: 3elx A:1-130 [175065] Other proteins in same PDB: d3elxa2, d3elxa3 automated match to d1o1ua_ complexed with edo |
PDB Entry: 3elx (more details), 1.6 Å
SCOPe Domain Sequences for d3elxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3elxa1 b.60.1.0 (A:1-130) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} afngkwetesqegyepfckligipddviakgrdfklvteivqngddftwtqyypnnhvvt nkfivgkesdmetvggkkfkgivsmeggkltisfpkyqqtteisggklvetstasgaqgt avlvrtskkv
Timeline for d3elxa1: