Lineage for d1bq7c1 (1bq7 C:65-128)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213823Fold a.44: Disulphide-bond formation facilitator (DSBA), insertion domain [47609] (1 superfamily)
    4 helices; bundle, partly opened, left-handed twist; up-and-down
  4. 213824Superfamily a.44.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47610] (1 family) (S)
    this domain interrupts the thioredoxin fold of the rest of protein
  5. 213825Family a.44.1.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47611] (1 protein)
  6. 213826Protein Disulphide-bond formation facilitator (DSBA), insertion domain [47612] (2 species)
  7. 213827Species Escherichia coli [TaxId:562] [47613] (12 PDB entries)
  8. 213843Domain d1bq7c1: 1bq7 C:65-128 [17506]
    Other proteins in same PDB: d1bq7a2, d1bq7b2, d1bq7c2, d1bq7d2, d1bq7e2, d1bq7f2

Details for d1bq7c1

PDB Entry: 1bq7 (more details), 2.8 Å

PDB Description: dsba mutant p151a, role of the cis-proline in the active site of dsba

SCOP Domain Sequences for d1bq7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq7c1 a.44.1.1 (C:65-128) Disulphide-bond formation facilitator (DSBA), insertion domain {Escherichia coli}
ggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgeeyda
awns

SCOP Domain Coordinates for d1bq7c1:

Click to download the PDB-style file with coordinates for d1bq7c1.
(The format of our PDB-style files is described here.)

Timeline for d1bq7c1: