SCOPe 2.06: Domain d3el1b_: 3el1 B:

Lineage for d3el1b_ (3el1 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)

8. Domain d3el1b_: 3el1 B: [175044]
   automated match to d1kzka_
   complexed with act, dr7

Details for d3el1b_

PDB Entry: 3el1, 1.7 Å

PDB Description: crystal structure of wild-type hiv protease in complex with the inhibitor, atazanavir

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3el1b_:

Sequence; same for both SEQRES and ATOM records:

>d3el1b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3el1b_:

• d3el1b_ first appeared in SCOPe 2.01
  
• d3el1b_ appears in SCOPe 2.05
  
• d3el1b_ appears in SCOPe 2.07
  
• d3el1b_ appears in the current release, SCOPe 2.08