Lineage for d3el0a_ (3el0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799148Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)
  8. 2799153Domain d3el0a_: 3el0 A: [175041]
    automated match to d1mt7a_
    complexed with 1un, act, po4

Details for d3el0a_

PDB Entry: 3el0 (more details), 2 Å

PDB Description: crystal structure of the inhibitor nelfinavir (nfv) in complex with a multi-drug resistant hiv-1 protease variant (l10i/g48v/i54v/v64i/v82a) (refer: flap+ in citation)
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3el0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3el0a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf

SCOPe Domain Coordinates for d3el0a_:

Click to download the PDB-style file with coordinates for d3el0a_.
(The format of our PDB-style files is described here.)

Timeline for d3el0a_: