Lineage for d3ekrb1 (3ekr B:9-225)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2212983Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2212984Protein HSP90 [55876] (3 species)
  7. 2213070Species Human (Homo sapiens) [TaxId:9606] [55878] (93 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2213128Domain d3ekrb1: 3ekr B:9-225 [175028]
    Other proteins in same PDB: d3ekra2, d3ekrb2
    automated match to d1osfa_
    complexed with po4, py9

Details for d3ekrb1

PDB Entry: 3ekr (more details), 2 Å

PDB Description: Dihydroxylphenyl amides as inhibitors of the Hsp90 molecular chaperone
PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3ekrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ekrb1 d.122.1.1 (B:9-225) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfveke

SCOPe Domain Coordinates for d3ekrb1:

Click to download the PDB-style file with coordinates for d3ekrb1.
(The format of our PDB-style files is described here.)

Timeline for d3ekrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ekrb2