Lineage for d1fvja1 (1fvj A:65-128)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3663Fold a.44: Disulphide-bond formation facilitator (DSBA), insertion domain [47609] (1 superfamily)
  4. 3664Superfamily a.44.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47610] (1 family) (S)
  5. 3665Family a.44.1.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47611] (1 protein)
  6. 3666Protein Disulphide-bond formation facilitator (DSBA), insertion domain [47612] (2 species)
  7. 3667Species Escherichia coli [TaxId:562] [47613] (12 PDB entries)
  8. 3678Domain d1fvja1: 1fvj A:65-128 [17500]
    Other proteins in same PDB: d1fvja2, d1fvjb2

Details for d1fvja1

PDB Entry: 1fvj (more details), 2.06 Å

PDB Description: the 2.06 angstrom structure of the h32y mutant of the disulfide bond formation protein (dsba)

SCOP Domain Sequences for d1fvja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvja1 a.44.1.1 (A:65-128) Disulphide-bond formation facilitator (DSBA), insertion domain {Escherichia coli}
ggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgeeyda
awns

SCOP Domain Coordinates for d1fvja1:

Click to download the PDB-style file with coordinates for d1fvja1.
(The format of our PDB-style files is described here.)

Timeline for d1fvja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fvja2