Lineage for d1dsbb1 (1dsb B:65-128)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281496Fold a.44: Disulphide-bond formation facilitator (DSBA), insertion domain [47609] (1 superfamily)
    4 helices; bundle, partly opened, left-handed twist; up-and-down
  4. 281497Superfamily a.44.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47610] (1 family) (S)
    this domain interrupts the thioredoxin fold of the rest of protein
  5. 281498Family a.44.1.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47611] (1 protein)
  6. 281499Protein Disulphide-bond formation facilitator (DSBA), insertion domain [47612] (2 species)
  7. 281500Species Escherichia coli [TaxId:562] [47613] (12 PDB entries)
  8. 281506Domain d1dsbb1: 1dsb B:65-128 [17498]
    Other proteins in same PDB: d1dsba2, d1dsbb2

Details for d1dsbb1

PDB Entry: 1dsb (more details), 2 Å

PDB Description: crystal structure of the dsba protein required for disulphide bond formation in vivo

SCOP Domain Sequences for d1dsbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsbb1 a.44.1.1 (B:65-128) Disulphide-bond formation facilitator (DSBA), insertion domain {Escherichia coli}
ggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgeeyda
awns

SCOP Domain Coordinates for d1dsbb1:

Click to download the PDB-style file with coordinates for d1dsbb1.
(The format of our PDB-style files is described here.)

Timeline for d1dsbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dsbb2