Lineage for d1dyva1 (1dyv A:155-189A,A:1-29)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213823Fold a.44: Disulphide-bond formation facilitator (DSBA), insertion domain [47609] (1 superfamily)
    4 helices; bundle, partly opened, left-handed twist; up-and-down
  4. 213824Superfamily a.44.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47610] (1 family) (S)
    this domain interrupts the thioredoxin fold of the rest of protein
  5. 213825Family a.44.1.1: Disulphide-bond formation facilitator (DSBA), insertion domain [47611] (1 protein)
  6. 213826Protein Disulphide-bond formation facilitator (DSBA), insertion domain [47612] (2 species)
  7. 213827Species Escherichia coli [TaxId:562] [47613] (12 PDB entries)
  8. 213851Domain d1dyva1: 1dyv A:155-189A,A:1-29 [17496]
    Other proteins in same PDB: d1dyva2
    circularly permuted cpdsba_q100t99

Details for d1dyva1

PDB Entry: 1dyv (more details), 1.7 Å

PDB Description: crystal structure of circularly permuted cpdsba_q100t99

SCOP Domain Sequences for d1dyva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyva1 a.44.1.1 (A:155-189A,A:1-29) Disulphide-bond formation facilitator (DSBA), insertion domain {Escherichia coli}
ggdlgkdltqawavamalgvedkvtvplfegvqktlXqtirsasdirdvfinagikgeey
daawns

SCOP Domain Coordinates for d1dyva1:

Click to download the PDB-style file with coordinates for d1dyva1.
(The format of our PDB-style files is described here.)

Timeline for d1dyva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dyva2