Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (18 species) not a true protein |
Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) |
Domain d3eica1: 3eic A:2-131 [174944] Other proteins in same PDB: d3eica2, d3eicb2, d3eicc2, d3eicd2, d3eice2, d3eicf2 automated match to d2b8pa1 complexed with mg, udp |
PDB Entry: 3eic (more details), 2.3 Å
SCOPe Domain Sequences for d3eica1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eica1 d.58.6.1 (A:2-131) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]} qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav deisiwfpet
Timeline for d3eica1: