SCOPe 2.01: Domain d3ehxa_: 3ehx A:

Lineage for d3ehxa_ (3ehx A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (29 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d3ehxa_: 3ehx A: [174942]
   automated match to d1os2a_
   complexed with bdl, ca, zn

Details for d3ehxa_

PDB Entry: 3ehx, 1.9 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor (r)-2-(biphenyl-4-ylsulfonamido)-4-methylpentanoic acid

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3ehxa_:

Sequence; same for both SEQRES and ATOM records:

>d3ehxa_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d3ehxa_:

• d3ehxa_ is new in SCOPe 2.01-stable
  
• d3ehxa_ appears in SCOPe 2.02
  
• d3ehxa_ appears in the current release, SCOPe 2.08