![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (22 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85963] [188967] (1 PDB entry) |
![]() | Domain d3egmc_: 3egm C: [174928] automated match to d1krqa_ complexed with fe, gol |
PDB Entry: 3egm (more details), 2.1 Å
SCOPe Domain Sequences for d3egmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3egmc_ a.25.1.1 (C:) automated matches {Helicobacter pylori [TaxId: 85963]} hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d3egmc_: