Lineage for d3egmb_ (3egm B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485319Protein automated matches [190041] (24 species)
    not a true protein
  7. 1485533Species Helicobacter pylori [TaxId:85963] [188967] (1 PDB entry)
  8. 1485535Domain d3egmb_: 3egm B: [174927]
    automated match to d1krqa_
    complexed with fe, gol

Details for d3egmb_

PDB Entry: 3egm (more details), 2.1 Å

PDB Description: structural basis of iron transport gating in helicobacter pylori ferritin
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d3egmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3egmb_ a.25.1.1 (B:) automated matches {Helicobacter pylori [TaxId: 85963]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d3egmb_:

Click to download the PDB-style file with coordinates for d3egmb_.
(The format of our PDB-style files is described here.)

Timeline for d3egmb_: