Class b: All beta proteins [48724] (177 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins) this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain |
Protein automated matches [190704] (4 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [188603] (1 PDB entry) |
Domain d3eeva_: 3eev A: [174903] automated match to d1xata_ complexed with mpd |
PDB Entry: 3eev (more details), 2.61 Å
SCOPe Domain Sequences for d3eeva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eeva_ b.81.1.3 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} nfftspfsgipldqqvtnpniivgkhsyysgyyhghsfddcvrylhperddvdklvigsf csigsgavfmmagnqghrsdwistfpffyqdndnfadardgftrsgdtiighdvwigtea mimpgvkighgaiiasrsvvtkdvapyevvgsnpakhikfrfsdveiamllemawwnwpe swlkesmqslcssdieglylnwqskar
Timeline for d3eeva_: