Lineage for d3eeva_ (3eev A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079733Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079734Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2079774Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 2079841Protein automated matches [190704] (4 species)
    not a true protein
  7. 2079866Species Vibrio cholerae [TaxId:243277] [188603] (1 PDB entry)
  8. 2079867Domain d3eeva_: 3eev A: [174903]
    automated match to d1xata_
    complexed with mpd

Details for d3eeva_

PDB Entry: 3eev (more details), 2.61 Å

PDB Description: Crystal Structure of Chloramphenicol Acetyltransferase VCA0300 from Vibrio cholerae O1 biovar eltor
PDB Compounds: (A:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d3eeva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eeva_ b.81.1.3 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
nfftspfsgipldqqvtnpniivgkhsyysgyyhghsfddcvrylhperddvdklvigsf
csigsgavfmmagnqghrsdwistfpffyqdndnfadardgftrsgdtiighdvwigtea
mimpgvkighgaiiasrsvvtkdvapyevvgsnpakhikfrfsdveiamllemawwnwpe
swlkesmqslcssdieglylnwqskar

SCOPe Domain Coordinates for d3eeva_:

Click to download the PDB-style file with coordinates for d3eeva_.
(The format of our PDB-style files is described here.)

Timeline for d3eeva_: