Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.0: automated matches [191395] (1 protein) not a true family |
Protein automated matches [190512] (3 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [188637] (3 PDB entries) |
Domain d3eera_: 3eer A: [174902] automated match to d1uspa_ complexed with act, imd, zn |
PDB Entry: 3eer (more details), 1.45 Å
SCOPe Domain Sequences for d3eera_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eera_ d.227.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} mstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaacfsna ilhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtvahqvcp ysnavrgnidvqvsvnglal
Timeline for d3eera_: