Lineage for d3eera_ (3eer A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564444Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 2564445Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 2564519Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 2564520Protein automated matches [190512] (5 species)
    not a true protein
  7. 2564527Species Vibrio cholerae [TaxId:243277] [188637] (3 PDB entries)
  8. 2564528Domain d3eera_: 3eer A: [174902]
    automated match to d1uspa_
    complexed with act, imd, zn

Details for d3eera_

PDB Entry: 3eer (more details), 1.45 Å

PDB Description: High resolution structure of putative organic hydroperoxide resistance protein from Vibrio cholerae O1 biovar eltor str. N16961
PDB Compounds: (A:) Organic hydroperoxide resistance protein, putative

SCOPe Domain Sequences for d3eera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eera_ d.227.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaacfsna
ilhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtvahqvcp
ysnavrgnidvqvsvnglal

SCOPe Domain Coordinates for d3eera_:

Click to download the PDB-style file with coordinates for d3eera_.
(The format of our PDB-style files is described here.)

Timeline for d3eera_: