Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (28 species) not a true protein |
Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries) |
Domain d3eelb1: 3eel B:3-217 [174898] Other proteins in same PDB: d3eela2, d3eelb2 automated match to d1ai9a_ complexed with 53t, ndp |
PDB Entry: 3eel (more details), 1.95 Å
SCOPe Domain Sequences for d3eelb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eelb1 c.71.1.0 (B:3-217) automated matches {Candida glabrata [TaxId: 5478]} kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq legrltsqewngelvkglpvqekgyqfyftlytkk
Timeline for d3eelb1: