Lineage for d3edha_ (3edh A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212831Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1212832Protein automated matches [190805] (5 species)
    not a true protein
  7. 1212838Species Human (Homo sapiens) [TaxId:9606] [188286] (12 PDB entries)
  8. 1212839Domain d3edha_: 3edh A: [174866]
    automated match to d1asta_
    complexed with ace, dms, zn

Details for d3edha_

PDB Entry: 3edh (more details), 1.25 Å

PDB Description: Crystal structure of bone morphogenetic protein 1 protease domain in complex with partially bound DMSO
PDB Compounds: (A:) Bone morphogenetic protein 1

SCOPe Domain Sequences for d3edha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3edha_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
qrtrlskgdiaqarklykcpa

SCOPe Domain Coordinates for d3edha_:

Click to download the PDB-style file with coordinates for d3edha_.
(The format of our PDB-style files is described here.)

Timeline for d3edha_: