SCOP 1.65: Domain d1cmaa_: 1cma A:

Lineage for d1cmaa_ (1cma A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.43: Met repressor-like [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Met repressor-like [47598] (2 families)
   dimeric proteins; the N-termini form a small beta-sheet

5. Family a.43.1.2: CopG/MetJ-like bacterial repressors [47604] (3 proteins)

6. Protein Met repressor, MetJ (MetR) [47607] (1 species)

7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)

8. Domain d1cmaa_: 1cma A: [17486]

Details for d1cmaa_

PDB Entry: 1cma, 2.8 Å

PDB Description: met repressor/dna complex + s-adenosyl-methionine

SCOP Domain Sequences for d1cmaa_:

Sequence; same for both SEQRES and ATOM records:

>d1cmaa_ a.43.1.2 (A:) Met repressor, MetJ (MetR) {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

Timeline for d1cmaa_:

• d1cmaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmaa_ appears in SCOP 1.63
  
• d1cmaa_ appears in SCOP 1.67
  
• d1cmaa_ appears in the current release, SCOPe 2.08