SCOPe 2.08: Domain d3ecma_: 3ecm A:

Lineage for d3ecma_ (3ecm A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d3ecma_: 3ecm A: [174830]
   automated match to d1q9mc_
   complexed with mg, zn

Details for d3ecma_

PDB Entry: 3ecm, 1.9 Å

PDB Description: Crystal structure of the unliganded PDE8A catalytic domain

PDB Compounds: (A:) High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

SCOPe Domain Sequences for d3ecma_:

Sequence; same for both SEQRES and ATOM records:

>d3ecma_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddvppriarameneeywdfdifeleaathnrpliylglkmfarfgiceflhcsestlrsw
lqiieanyhssnpyhnsthsadvlhatayflskeriketldpidevaaliaatihdvdhp
grtnsflcnagselailyndtavleshhaalafqlttgddkcnifknmerndyrtlrqgi
idmvlatemtkhfehvnkfvnsinkplatleengetdknqevintmlrtpenrtlikrml
ikcadvsnpcrplqyciewaariseeyfsqtdeekqqglpvvmpvfdrntcsipksqisf
idyfitdmfdawdafvdlpdlmqhldnnfkywkgldem

Timeline for d3ecma_:

• d3ecma_ first appeared in SCOPe 2.01
  
• d3ecma_ appears in SCOPe 2.07