Lineage for d3ec6a_ (3ec6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794356Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2794357Protein automated matches [190439] (22 species)
    not a true protein
  7. 2794358Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188602] (1 PDB entry)
  8. 2794359Domain d3ec6a_: 3ec6 A: [174823]
    automated match to d2i02a1
    complexed with fad, so4

Details for d3ec6a_

PDB Entry: 3ec6 (more details), 1.6 Å

PDB Description: Crystal structure of the General Stress Protein 26 from Bacillus anthracis str. Sterne
PDB Compounds: (A:) General stress protein 26

SCOPe Domain Sequences for d3ec6a_:

Sequence, based on SEQRES records: (download)

>d3ec6a_ b.45.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mhlkekittiiqgqrtgvlstvrndkphsafmmffhedfvlyvatdrqskkitdiennpn
vhvllgregkkldedyieveglasieedstlknkfwnnslkrwllrpedpnyvlikinpd
tiyyidgagttepeflrl

Sequence, based on observed residues (ATOM records): (download)

>d3ec6a_ b.45.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mhlkekittiiqgqrtgvlstvrndkphsafmmffhedfvlyvatdrqskkitdiennpn
vhvllgrkldedyieveglasieedstlknkfwnnslkrwllrpedpnyvlikinpdtiy
yidpeflrl

SCOPe Domain Coordinates for d3ec6a_:

Click to download the PDB-style file with coordinates for d3ec6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ec6a_: