Lineage for d3ebab_ (3eba B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2925556Protein automated matches [190299] (8 species)
    not a true protein
  7. 2925627Species Human (Homo sapiens) [TaxId:9606] [188701] (6 PDB entries)
  8. 2925632Domain d3ebab_: 3eba B: [174816]
    Other proteins in same PDB: d3ebaa1, d3ebaa2
    automated match to d1c7pa_
    complexed with so4; mutant

Details for d3ebab_

PDB Entry: 3eba (more details), 1.85 Å

PDB Description: CAbHul6 FGLW mutant (humanized) in complex with human lysozyme
PDB Compounds: (B:) Lysozyme C

SCOPe Domain Sequences for d3ebab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ebab_ d.2.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d3ebab_:

Click to download the PDB-style file with coordinates for d3ebab_.
(The format of our PDB-style files is described here.)

Timeline for d3ebab_: