Class a: All alpha proteins [46456] (179 folds) |
Fold a.43: Met repressor-like [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Met repressor-like [47598] (2 families) dimeric proteins; the N-termini form a small beta-sheet |
Family a.43.1.2: CopG/MetJ-like bacterial repressors [47604] (3 proteins) |
Protein Met repressor, MetJ (MetR) [47607] (1 species) |
Species Escherichia coli [TaxId:562] [47608] (10 PDB entries) |
Domain d1mjqc_: 1mjq C: [17480] |
PDB Entry: 1mjq (more details), 2.4 Å
SCOP Domain Sequences for d1mjqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mjqc_ a.43.1.2 (C:) Met repressor, MetJ (MetR) {Escherichia coli} aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea flhaftgqplpddadlrkersdeipeaakeimremginpetwey
Timeline for d1mjqc_: