Lineage for d3e6sf_ (3e6s F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990252Protein Non-hem ferritin [63524] (7 species)
  7. 1990278Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries)
  8. 1990290Domain d3e6sf_: 3e6s F: [174706]
    automated match to d1vlga_
    complexed with fe, so4

Details for d3e6sf_

PDB Entry: 3e6s (more details), 1.95 Å

PDB Description: crystal structure of ferritin soaked with iron from pseudo-nitzschia multiseries
PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d3e6sf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6sf_ a.25.1.1 (F:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf

SCOPe Domain Coordinates for d3e6sf_:

Click to download the PDB-style file with coordinates for d3e6sf_.
(The format of our PDB-style files is described here.)

Timeline for d3e6sf_: