SCOPe 2.01: Domain d3e5ha_: 3e5h A:

Lineage for d3e5ha_ (3e5h A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (23 PDB entries)

8. Domain d3e5ha_: 3e5h A: [174671]
   automated match to d1d5ca_
   complexed with gnp, gol, mg

Details for d3e5ha_

PDB Entry: 3e5h, 1.5 Å

PDB Description: crystal structure of rab28 gtpase in the active (gppnhp-bound) form

PDB Compounds: (A:) Ras-related protein Rab-28

SCOPe Domain Sequences for d3e5ha_:

Sequence; same for both SEQRES and ATOM records:

>d3e5ha_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmrqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqi
wdiggqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplval
vgnkidlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgikln

Timeline for d3e5ha_:

• d3e5ha_ is new in SCOPe 2.01-stable
  
• d3e5ha_ appears in SCOPe 2.02
  
• d3e5ha_ appears in the current release, SCOPe 2.08, called d3e5ha1