Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (56 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [188961] (3 PDB entries) |
Domain d3e4df_: 3e4d F: [174652] automated match to d1pv1a_ complexed with cl, mg |
PDB Entry: 3e4d (more details), 2.01 Å
SCOPe Domain Sequences for d3e4df_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e4df_ c.69.1.0 (F:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} mniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanvm ekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmys yvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssad wsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeaik gtdigltlrmhdrydhsyyfistfmddhlkwhaerlg
Timeline for d3e4df_: