SCOPe 2.08: Domain d3e4db1: 3e4d B:1-277

Lineage for d3e4db1 (3e4d B:1-277)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [188961] (3 PDB entries)

8. Domain d3e4db1: 3e4d B:1-277 [174648]
   Other proteins in same PDB: d3e4da2, d3e4db2, d3e4dc2, d3e4de2
   automated match to d1pv1a_
   complexed with cl, mg

Details for d3e4db1

PDB Entry: 3e4d, 2.01 Å

PDB Description: structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens

PDB Compounds: (B:) Esterase D

SCOPe Domain Sequences for d3e4db1:

Sequence; same for both SEQRES and ATOM records:

>d3e4db1 c.69.1.0 (B:1-277) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mniisqntafggmqgvfshqsetlksemtfavyvppkaihepcpvvwylsgltcthanvm
ekgeyrrmaselglvvvcpdtsprgndvpdeltnwqmgkgagfyldateepwsehyqmys
yvteelpaligqhfradmsrqsifghsmgghgamtialknperfkscsafapivapssad
wsepalekylgadraawrrydacslvedgarfpeflidqgkadsflekglrpwlfeeaik
gtdigltlrmhdrydhsyyfistfmddhlkwhaerlg

Timeline for d3e4db1:

• d3e4db1 first appeared in SCOPe 2.01, called d3e4db_
  
• d3e4db1 appears in SCOPe 2.07