Lineage for d1cmcb_ (1cmc B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281399Fold a.43: Met repressor-like [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 281400Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
    dimeric proteins; the N-termini form a small beta-sheet
  5. 281442Family a.43.1.2: CopG/MetJ-like bacterial repressors [47604] (3 proteins)
  6. 281443Protein Met repressor, MetJ (MetR) [47607] (1 species)
  7. 281444Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. 281448Domain d1cmcb_: 1cmc B: [17463]
    complexed with mg, sam

Details for d1cmcb_

PDB Entry: 1cmc (more details), 1.8 Å

PDB Description: three dimensional crystal structures of e. coli met repressor with and without corepressor

SCOP Domain Sequences for d1cmcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmcb_ a.43.1.2 (B:) Met repressor, MetJ (MetR) {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrqvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOP Domain Coordinates for d1cmcb_:

Click to download the PDB-style file with coordinates for d1cmcb_.
(The format of our PDB-style files is described here.)

Timeline for d1cmcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cmca_