SCOPe 2.04: Domain d3e3qf_: 3e3q F:

Lineage for d3e3qf_ (3e3q F:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)

8. Domain d3e3qf_: 3e3q F: [174626]
   automated match to d2icwj1
   mutant

Details for d3e3qf_

PDB Entry: 3e3q, 2.95 Å

PDB Description: structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9

PDB Compounds: (F:) TCR beta chain

SCOPe Domain Sequences for d3e3qf_:

Sequence; same for both SEQRES and ATOM records:

>d3e3qf_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls

Timeline for d3e3qf_:

• d3e3qf_ first appeared in SCOPe 2.01
  
• d3e3qf_ appears in SCOPe 2.03
  
• d3e3qf_ appears in SCOPe 2.05
  
• d3e3qf_ appears in the current release, SCOPe 2.08