Lineage for d3e2zb_ (3e2z B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867712Species Mouse (Mus musculus) [TaxId:10090] [188700] (5 PDB entries)
  8. 1867718Domain d3e2zb_: 3e2z B: [174581]
    automated match to d1w7la_
    complexed with gol, kyn, pmp

Details for d3e2zb_

PDB Entry: 3e2z (more details), 2.81 Å

PDB Description: crystal structure of mouse kynurenine aminotransferase iii in complex with kynurenine
PDB Compounds: (B:) Kynurenine-oxoglutarate transaminase 3

SCOPe Domain Sequences for d3e2zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e2zb_ c.67.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn

SCOPe Domain Coordinates for d3e2zb_:

Click to download the PDB-style file with coordinates for d3e2zb_.
(The format of our PDB-style files is described here.)

Timeline for d3e2zb_: