SCOPe 2.04: Domain d3e2za_: 3e2z A:

Lineage for d3e2za_ (3e2z A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (83 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188700] (5 PDB entries)

8. Domain d3e2za_: 3e2z A: [174580]
   automated match to d1w7la_
   complexed with gol, kyn, pmp

Details for d3e2za_

PDB Entry: 3e2z, 2.81 Å

PDB Description: crystal structure of mouse kynurenine aminotransferase iii in complex with kynurenine

PDB Compounds: (A:) Kynurenine-oxoglutarate transaminase 3

SCOPe Domain Sequences for d3e2za_:

Sequence; same for both SEQRES and ATOM records:

>d3e2za_ c.67.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn

Timeline for d3e2za_:

• d3e2za_ first appeared in SCOPe 2.01
  
• d3e2za_ appears in SCOPe 2.03
  
• d3e2za_ appears in SCOPe 2.05
  
• d3e2za_ appears in the current release, SCOPe 2.08