Class a: All alpha proteins [46456] (179 folds) |
Fold a.43: Met repressor-like [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Met repressor-like [47598] (2 families) dimeric proteins; the N-termini form a small beta-sheet |
Family a.43.1.2: CopG/MetJ-like bacterial repressors [47604] (3 proteins) |
Protein Transcriptional repressor CopG [47605] (1 species) plasmid-encoded, similar to the phage repressor family |
Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries) |
Domain d1b01a_: 1b01 A: [17458] |
PDB Entry: 1b01 (more details), 2.56 Å
SCOP Domain Sequences for d1b01a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b01a_ a.43.1.2 (A:) Transcriptional repressor CopG {Streptococcus agalactiae} mkkrltitlsesvlenlekmaremglsksamisvalenykkgq
Timeline for d1b01a_: