Lineage for d2cpga_ (2cpg A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281399Fold a.43: Met repressor-like [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 281400Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
    dimeric proteins; the N-termini form a small beta-sheet
  5. 281442Family a.43.1.2: CopG/MetJ-like bacterial repressors [47604] (3 proteins)
  6. 281479Protein Transcriptional repressor CopG [47605] (1 species)
    plasmid-encoded, similar to the phage repressor family
  7. 281480Species Streptococcus agalactiae [TaxId:1311] [47606] (3 PDB entries)
  8. 281481Domain d2cpga_: 2cpg A: [17455]

Details for d2cpga_

PDB Entry: 2cpg (more details), 1.6 Å

PDB Description: transcriptional repressor copg

SCOP Domain Sequences for d2cpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpga_ a.43.1.2 (A:) Transcriptional repressor CopG {Streptococcus agalactiae}
mkkrltitlsesvlenlekmaremglsksamisvalenykkgq

SCOP Domain Coordinates for d2cpga_:

Click to download the PDB-style file with coordinates for d2cpga_.
(The format of our PDB-style files is described here.)

Timeline for d2cpga_: