Lineage for d3e1qj_ (3e1q J:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264313Protein Bacterioferritin (cytochrome b1) [47244] (5 species)
    binds heme between two subunits; 24-mer
  7. 1264392Species Escherichia coli [TaxId:562] [47245] (11 PDB entries)
  8. 1264458Domain d3e1qj_: 3e1q J: [174530]
    automated match to d1bcfa_
    complexed with fe2, hem, so4

Details for d3e1qj_

PDB Entry: 3e1q (more details), 2.6 Å

PDB Description: crystal structure of w133f variant e. coli bacterioferritn with iron.
PDB Compounds: (J:) bacterioferritin

SCOPe Domain Sequences for d3e1qj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e1qj_ a.25.1.1 (J:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidfleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d3e1qj_:

Click to download the PDB-style file with coordinates for d3e1qj_.
(The format of our PDB-style files is described here.)

Timeline for d3e1qj_: