Lineage for d3e1pj_ (3e1p J:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314572Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2314700Species Escherichia coli [TaxId:562] [47245] (13 PDB entries)
  8. 2314746Domain d3e1pj_: 3e1p J: [174518]
    automated match to d1bcfa_
    complexed with fe2, hem, so4, zn

Details for d3e1pj_

PDB Entry: 3e1p (more details), 2.4 Å

PDB Description: Crystal structure of E. coli Bacterioferritin (BFR) in which the Ferroxidase centre is inhibited with ZN(II) and high occupancy iron is bound within the cavity.
PDB Compounds: (J:) bacterioferritin

SCOPe Domain Sequences for d3e1pj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e1pj_ a.25.1.1 (J:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d3e1pj_:

Click to download the PDB-style file with coordinates for d3e1pj_.
(The format of our PDB-style files is described here.)

Timeline for d3e1pj_: