| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Bacterioferritin (cytochrome b1) [47244] (5 species) binds heme between two subunits; 24-mer |
| Species Escherichia coli [TaxId:562] [47245] (11 PDB entries) |
| Domain d3e1oi_: 3e1o I: [174505] automated match to d1bcfa_ complexed with hem, so4, zn |
PDB Entry: 3e1o (more details), 2.95 Å
SCOPe Domain Sequences for d3e1oi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1oi_ a.25.1.1 (I:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqire
Timeline for d3e1oi_: