Lineage for d3e1md_ (3e1m D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314572Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2314700Species Escherichia coli [TaxId:562] [47245] (13 PDB entries)
  8. 2314796Domain d3e1md_: 3e1m D: [174476]
    automated match to d1bcfa_
    complexed with fe2, hem, so4

Details for d3e1md_

PDB Entry: 3e1m (more details), 2.7 Å

PDB Description: crystal structure of e. coli bacterioferritin (bfr) obtained after soaking apo-bfr crystals for 2.5 minutes in fe2+ (2.5m fe(ii)-bfr)
PDB Compounds: (D:) bacterioferritin

SCOPe Domain Sequences for d3e1md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e1md_ a.25.1.1 (D:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d3e1md_:

Click to download the PDB-style file with coordinates for d3e1md_.
(The format of our PDB-style files is described here.)

Timeline for d3e1md_: