| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
| Species Escherichia coli K-12 [TaxId:83333] [188868] (9 PDB entries) |
| Domain d3e1jh_: 3e1j H: [174456] automated match to d1bcfa_ complexed with hem, so4 |
PDB Entry: 3e1j (more details), 2.7 Å
SCOPe Domain Sequences for d3e1jh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1jh_ a.25.1.1 (H:) Bacterioferritin (cytochrome b1) {Escherichia coli K-12 [TaxId: 83333]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg
Timeline for d3e1jh_: