Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (56 species) not a true protein |
Species Lactobacillus rhamnosus [TaxId:486408] [188926] (5 PDB entries) |
Domain d3e1ga_: 3e1g A: [174448] automated match to d1r1da_ complexed with dep |
PDB Entry: 3e1g (more details), 2.2 Å
SCOPe Domain Sequences for d3e1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1ga_ c.69.1.0 (A:) automated matches {Lactobacillus rhamnosus [TaxId: 486408]} frkpqpfeyegtdtgvvllhaytgspndmnfmaralqrsgygvyvplfsghgtvepldil tkgnpdiwwaessaavahmtakyakvfvfglslggifamkaletlpgitaggvfsspilp gkhhlvpgflkyaeymnrlagksdestqilaylpgqlaaidqfattvaadlnlvkqptfi gqagqdelvdgrlayqlrdalinaarvdfhwyddakhvitvnsahhaleedviafmqqe
Timeline for d3e1ga_: