SCOPe 2.04: Domain d3e1ga_: 3e1g A:

Lineage for d3e1ga_ (3e1g A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (56 species)
   not a true protein

7. Species Lactobacillus rhamnosus [TaxId:486408] [188926] (5 PDB entries)

8. Domain d3e1ga_: 3e1g A: [174448]
   automated match to d1r1da_
   complexed with dep

Details for d3e1ga_

PDB Entry: 3e1g, 2.2 Å

PDB Description: Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism

PDB Compounds: (A:) Esterase D

SCOPe Domain Sequences for d3e1ga_:

Sequence; same for both SEQRES and ATOM records:

>d3e1ga_ c.69.1.0 (A:) automated matches {Lactobacillus rhamnosus [TaxId: 486408]}
frkpqpfeyegtdtgvvllhaytgspndmnfmaralqrsgygvyvplfsghgtvepldil
tkgnpdiwwaessaavahmtakyakvfvfglslggifamkaletlpgitaggvfsspilp
gkhhlvpgflkyaeymnrlagksdestqilaylpgqlaaidqfattvaadlnlvkqptfi
gqagqdelvdgrlayqlrdalinaarvdfhwyddakhvitvnsahhaleedviafmqqe

Timeline for d3e1ga_:

• d3e1ga_ first appeared in SCOPe 2.01
  
• d3e1ga_ appears in SCOPe 2.03
  
• d3e1ga_ appears in SCOPe 2.05
  
• d3e1ga_ appears in the current release, SCOPe 2.08