SCOPe 2.06: Domain d3e0qa_: 3e0q A:

Lineage for d3e0qa_ (3e0q A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (41 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [188022] (27 PDB entries)

8. Domain d3e0qa_: 3e0q A: [174441]
   automated match to d1a9oa_
   complexed with dms, jfd

Details for d3e0qa_

PDB Entry: 3e0q, 1.9 Å

PDB Description: Crystal structure of Schistosoma mansoni purine nucleoside phosphorylase complexed with a novel monocyclic inhibitor

PDB Compounds: (A:) purine-nucleoside phosphorylase

SCOPe Domain Sequences for d3e0qa_:

Sequence, based on SEQRES records:

>d3e0qa_ c.56.2.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
vtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtsvv
ghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnr
slklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeeng
fgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvt
nisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd

Sequence, based on observed residues (ATOM records):

>d3e0qa_ c.56.2.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
vtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtshs
gnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrslk
lgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfgn
lvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtnis
vldvesdlkpnheevlatgaqraelmqswfekiieklpkd

Timeline for d3e0qa_:

• d3e0qa_ first appeared in SCOPe 2.01
  
• d3e0qa_ appears in SCOPe 2.05
  
• d3e0qa_ appears in SCOPe 2.07
  
• d3e0qa_ appears in the current release, SCOPe 2.08