Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Geobacter metallireducens [TaxId:269799] [188557] (1 PDB entry) |
Domain d3e05g_: 3e05 G: [174428] automated match to d1f38a_ complexed with cl, gol |
PDB Entry: 3e05 (more details), 1.8 Å
SCOPe Domain Sequences for d3e05g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e05g_ c.66.1.0 (G:) automated matches {Geobacter metallireducens [TaxId: 269799]} ypvigidddefatakklitkqevravtlsklrlqddlvmwdigagsasvsieasnlmpng rifalernpqylgfirdnlkkfvarnvtlveafapeglddlpdpdrvfiggsggmleeii davdrrlksegvivlnavtldtltkavefledhgymvevacvnvaktkglteykmfeshn pvyiitawk
Timeline for d3e05g_: