Lineage for d3e05f_ (3e05 F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146732Species Geobacter metallireducens [TaxId:269799] [188557] (1 PDB entry)
  8. 2146738Domain d3e05f_: 3e05 F: [174427]
    automated match to d1f38a_
    complexed with cl, gol

Details for d3e05f_

PDB Entry: 3e05 (more details), 1.8 Å

PDB Description: crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15
PDB Compounds: (F:) Precorrin-6Y C5,15-methyltransferase (Decarboxylating)

SCOPe Domain Sequences for d3e05f_:

Sequence, based on SEQRES records: (download)

>d3e05f_ c.66.1.0 (F:) automated matches {Geobacter metallireducens [TaxId: 269799]}
qypvigidddefatakklitkqevravtlsklrlqddlvmwdigagsasvsieasnlmpn
grifalernpqylgfirdnlkkfvarnvtlveafapeglddlpdpdrvfiggsggmleei
idavdrrlksegvivlnavtldtltkavefledhgymvevacvnvaktkglteykmfesh
npvyiitawks

Sequence, based on observed residues (ATOM records): (download)

>d3e05f_ c.66.1.0 (F:) automated matches {Geobacter metallireducens [TaxId: 269799]}
qypvigidddefatakklitkqevravtlsklrlqddlvmwdigagsasvsieasnlmpn
grifalernpqylgfirdnlkkfvarnvtlveafapeglddlpdpdrvfiggsggmleei
idavdrrlksegvivlnavtldtltkavefledhgymvevacvnvaktkgkmfeshnpvy
iitawks

SCOPe Domain Coordinates for d3e05f_:

Click to download the PDB-style file with coordinates for d3e05f_.
(The format of our PDB-style files is described here.)

Timeline for d3e05f_: