SCOPe 2.08: Domain d3dzzb_: 3dzz B:

Lineage for d3dzzb_ (3dzz B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Lactobacillus delbrueckii [TaxId:321956] [188555] (1 PDB entry)

8. Domain d3dzzb_: 3dzz B: [174420]
   automated match to d1c7na_
   complexed with act, ca, cl, peg, pg4

Details for d3dzzb_

PDB Entry: 3dzz, 1.61 Å

PDB Description: crystal structure of a putative plp-dependent aminotransferase (lbul_1103) from lactobacillus delbrueckii subsp. at 1.61 a resolution

PDB Compounds: (B:) putative pyridoxal 5'-phosphate-dependent C-S lyase

SCOPe Domain Sequences for d3dzzb_:

Sequence; same for both SEQRES and ATOM records:

>d3dzzb_ c.67.1.0 (B:) automated matches {Lactobacillus delbrueckii [TaxId: 321956]}
kqydfthvpkrqgnsikwgvlkekelpmwiaemdfkiapeimasmeeklkvaafgyesvp
aeyykavadweeiehrarpkedwcvfasgvvpaisamvrqftspgdqilvqepvynmfys
viegngrrvissdliyenskysvnwadleeklatpsvrmmvfcnphnpigyawseeevkr
iaelcakhqvllisdeihgdlvltdeditpaftvdwdaknwvvslispsktfnlaalhaa
caiipnpdlraraeesfflagigepnllaipaaiaayeeghdwlrelkqvlrdnfayare
flakevpevkvldsnasylawvdisalgmnaedfckylrektgliisagngyrgnghefv
rinlacpkelvidgmqrlkqgvlnl

Timeline for d3dzzb_:

• d3dzzb_ first appeared in SCOPe 2.01
  
• d3dzzb_ appears in SCOPe 2.07