Lineage for d3dz1a1 (3dz1 A:2-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836569Species Rhodopseudomonas palustris [TaxId:1076] [188556] (2 PDB entries)
  8. 2836570Domain d3dz1a1: 3dz1 A:2-300 [174396]
    Other proteins in same PDB: d3dz1a2
    automated match to d1s5ta_

Details for d3dz1a1

PDB Entry: 3dz1 (more details), 1.87 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 1.87a resolution
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3dz1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dz1a1 c.1.10.0 (A:2-300) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
kltpeaagtfaiaptpfhddgkiddvsidrltdfyaevgcegvtvlgilgeapkldaaea
eavatrfikraksmqvivgvsapgfaamrrlarlsmdagaagvmiapppslrtdeqitty
frqateaigddvpwvlqdypltlsvvmtpkvirqivmdsascvmlkhedwpglekittlr
gfqkdgslrplsilcgngglfldfemergadgamtgycfpdmlvdvvklskagqrdlahn
lfdahlpliryehqqgvglsvrkyvlkkrgllsssaqrkpgasltdtareevdyllsrl

SCOPe Domain Coordinates for d3dz1a1:

Click to download the PDB-style file with coordinates for d3dz1a1.
(The format of our PDB-style files is described here.)

Timeline for d3dz1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dz1a2