SCOPe 2.08: Domain d3dyva_: 3dyv A:

Lineage for d3dyva_ (3dyv A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Lactobacillus rhamnosus [TaxId:486408] [188926] (5 PDB entries)

8. Domain d3dyva_: 3dyv A: [174395]
   automated match to d1r1da_
   complexed with cl

Details for d3dyva_

PDB Entry: 3dyv, 1.81 Å

PDB Description: Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism

PDB Compounds: (A:) Esterase D

SCOPe Domain Sequences for d3dyva_:

Sequence; same for both SEQRES and ATOM records:

>d3dyva_ c.69.1.0 (A:) automated matches {Lactobacillus rhamnosus [TaxId: 486408]}
frkpqpfeyegtdtgvvllhaytgspndmnfmaralqrsgygvyvplfsghgtvepldil
tkgnpdiwwaessaavahmtakyakvfvfglslggifamkaletlpgitaggvfsspilp
gkhhlvpgflkyaeymnrlagksdestqilaylpgqlaaidqfattvaadlnlvkqptfi
gqagqdelvdgrlayqlrdalinaarvdfhwyddakhvitvnsahhaleedviafmqq

Timeline for d3dyva_:

• d3dyva_ first appeared in SCOPe 2.01
  
• d3dyva_ appears in SCOPe 2.07