![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein Proteasome beta subunit (catalytic) [56252] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries) The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8) |
![]() | Domain d3dy4k_: 3dy4 K: [174373] Other proteins in same PDB: d3dy4a_, d3dy4b_, d3dy4c_, d3dy4e_, d3dy4f_, d3dy4g_, d3dy4o_, d3dy4p_, d3dy4q_, d3dy4s_, d3dy4t_, d3dy4u_ automated match to d1g0uk_ complexed with sla |
PDB Entry: 3dy4 (more details), 2.8 Å
SCOPe Domain Sequences for d3dy4k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dy4k_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv tedgwiyhgnhdvgelfwkvkeeegsfnnvig
Timeline for d3dy4k_:
![]() Domains from other chains: (mouse over for more information) d3dy41_, d3dy42_, d3dy4a_, d3dy4b_, d3dy4c_, d3dy4d_, d3dy4e_, d3dy4f_, d3dy4g_, d3dy4h_, d3dy4i_, d3dy4j_, d3dy4l_, d3dy4m_, d3dy4n_, d3dy4o_, d3dy4p_, d3dy4q_, d3dy4r_, d3dy4s_, d3dy4t_, d3dy4u_, d3dy4v_, d3dy4w_, d3dy4x_, d3dy4y_, d3dy4z_ |