Lineage for d3dy4g_ (3dy4 G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439179Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (34 PDB entries)
  8. 1439339Domain d3dy4g_: 3dy4 G: [174369]
    Other proteins in same PDB: d3dy41_, d3dy42_, d3dy4a_, d3dy4b_, d3dy4c_, d3dy4d_, d3dy4e_, d3dy4f_, d3dy4h_, d3dy4i_, d3dy4j_, d3dy4k_, d3dy4l_, d3dy4m_, d3dy4n_, d3dy4o_, d3dy4p_, d3dy4q_, d3dy4r_, d3dy4s_, d3dy4t_, d3dy4v_, d3dy4w_, d3dy4x_, d3dy4y_, d3dy4z_
    automated match to d1g65g_
    complexed with sla

Details for d3dy4g_

PDB Entry: 3dy4 (more details), 2.8 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with spirolactacystin
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3dy4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dy4g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3dy4g_:

Click to download the PDB-style file with coordinates for d3dy4g_.
(The format of our PDB-style files is described here.)

Timeline for d3dy4g_: