SCOPe 2.05: Domain d3dy3g_: 3dy3 G:

Lineage for d3dy3g_ (3dy3 G:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (7 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries)

8. Domain d3dy3g_: 3dy3 G: [174343]
   Other proteins in same PDB: d3dy31_, d3dy32_, d3dy3a_, d3dy3b_, d3dy3c_, d3dy3d_, d3dy3e_, d3dy3f_, d3dy3h_, d3dy3i_, d3dy3j_, d3dy3k_, d3dy3l_, d3dy3m_, d3dy3n_, d3dy3o_, d3dy3p_, d3dy3q_, d3dy3r_, d3dy3s_, d3dy3t_, d3dy3v_, d3dy3w_, d3dy3x_, d3dy3y_, d3dy3z_
   automated match to d1g65g_
   complexed with slr

Details for d3dy3g_

PDB Entry: 3dy3, 2.81 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with the epimer form of spirolactacystin

PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3dy3g_:

Sequence; same for both SEQRES and ATOM records:

>d3dy3g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

Timeline for d3dy3g_:

• d3dy3g_ first appeared in SCOPe 2.01
  
• d3dy3g_ appears in SCOPe 2.04
  
• d3dy3g_ appears in SCOPe 2.06
  
• d3dy3g_ appears in the current release, SCOPe 2.08