Lineage for d3dy3g_ (3dy3 G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2552815Domain d3dy3g_: 3dy3 G: [174343]
    Other proteins in same PDB: d3dy31_, d3dy32_, d3dy3a_, d3dy3b_, d3dy3c_, d3dy3d_, d3dy3e_, d3dy3f_, d3dy3h_, d3dy3i_, d3dy3j_, d3dy3k_, d3dy3l_, d3dy3m_, d3dy3n_, d3dy3o_, d3dy3p_, d3dy3q_, d3dy3r_, d3dy3s_, d3dy3t_, d3dy3v_, d3dy3w_, d3dy3x_, d3dy3y_, d3dy3z_
    automated match to d1g65g_
    complexed with slr

Details for d3dy3g_

PDB Entry: 3dy3 (more details), 2.81 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with the epimer form of spirolactacystin
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3dy3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dy3g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3dy3g_:

Click to download the PDB-style file with coordinates for d3dy3g_.
(The format of our PDB-style files is described here.)

Timeline for d3dy3g_: