Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species) contains an extension to the common fold at the N-terminus |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (37 PDB entries) The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8) |
Domain d3dy3c_: 3dy3 C: [174340] Other proteins in same PDB: d3dy31_, d3dy32_, d3dy3d_, d3dy3g_, d3dy3h_, d3dy3i_, d3dy3j_, d3dy3k_, d3dy3l_, d3dy3m_, d3dy3n_, d3dy3r_, d3dy3u_, d3dy3v_, d3dy3w_, d3dy3x_, d3dy3y_, d3dy3z_ automated match to d1g65c_ complexed with slr |
PDB Entry: 3dy3 (more details), 2.81 Å
SCOPe Domain Sequences for d3dy3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dy3c_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe q
Timeline for d3dy3c_:
View in 3D Domains from other chains: (mouse over for more information) d3dy31_, d3dy32_, d3dy3a_, d3dy3b_, d3dy3d_, d3dy3e_, d3dy3f_, d3dy3g_, d3dy3h_, d3dy3i_, d3dy3j_, d3dy3k_, d3dy3l_, d3dy3m_, d3dy3n_, d3dy3o_, d3dy3p_, d3dy3q_, d3dy3r_, d3dy3s_, d3dy3t_, d3dy3u_, d3dy3v_, d3dy3w_, d3dy3x_, d3dy3y_, d3dy3z_ |